A glactose-specific lectin from sponge - Chondrilla nucula,69106-44-1 Products Supply

Name: A glactose-specific lectin from sponge - Chondrilla nucula
CAS NO.: 69106-44-1
Synonyms:
MVKCLLLSFLIIAIFIGVPTAKGDVNFDLSTATAKTYTKFIEDFRATLPFSHKVYDIPLL;Momordica anti-HIV protein from Momordica charantia seeds and fruit;170834-08-9;Momordica anti-HIV protein;Momordica charantia seeds and fruit;MVKCLLLSFLIIAIFIGVPTAKGDVNFDLSTATAKTYTKFIEDFRATLPFSHKVYDIPLL; Protein MAP 30 (Momordica charantia clone pM30A precursor)
Molecular Structure:
Molecular Formula: C₃₁₈H₄₉₉N₇₁O₈₃S₂

Send a message direct to supplier(s)*

Please post your buying leads,so that our qualified suppliers will soon contact you!

CAS NO.：
* Purchase Request：

* Your Email：
* Name：
* Gender：	Male Female
* Country/Area：
* Company Name：
* Tel：	- - Country - Code Area - Code Number

* Message：

Related products: A glactose-specific lectin fro; Cadmium, sponge; Wistarin (sponge); Mud crabThis heading is used o; Mullet (Mugilidae)redThis head; GuillemotThis heading is used ; MesquiteThis heading is used o; ManateeThis heading is used on; BlennyThis heading is used onl; NudibranchThis heading is used; TrumpetfishThis heading is use; LadybugThis heading is used on; Hermit crabThis heading is use; Ambrosia beetleThis heading is; StarlingThis heading is used o; PartridgeThis heading is used ; Embiotoca lateralisThis headin; Rock fishThis heading is used ; BrillThis heading is used only; NICKEL SPONGE METAL(TM) CATALY; pokeweed lectin D; Lectin, Soybean, Glycine soja; BS 2 lectin; Salmonid herpesvirusSalmonid h; Lectin II (Scotch broomseed) (; iron-deficiency specific prote; race-specific peptide elicitor; Proteinase,glycine-specific (9; Proteinase,lysine-specific; Nuclease, ribo- (purine-specif;